GREB1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10342

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GREB1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GREB1 (NP_683701). Peptide sequence MGNSYAGQLKTTRFEEVLHNSIEASLRSNNLVPRPIFSQLYLEAEQQLAA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GREB1 Antibody - BSA Free

Western Blot: GREB1 Antibody [NBP3-10342]

Western Blot: GREB1 Antibody [NBP3-10342]

Western Blot: GREB1 Antibody [NBP3-10342] - Western blot analysis of GREB1 in Pancreas Tumor lysates. Antibody dilution at 1.0ug/ml

Applications for GREB1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GREB1

GREB1 is an estrogen-responsive gene that is an early response gene in the estrogen receptor-regulated pathway. It is thought to play an important role in hormone-responsive tissues and cancer. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]. Transcript Variant: This variant (a) encodes the longest isoform (a).

Alternate Names

gene regulated by estrogen in breast cancer protein, growth regulation by estrogen in breast cancer 1, KIAA0575Gene regulated in breast cancer 1 protein, protein GREB1

Gene Symbol

GREB1

Additional GREB1 Products

Product Documents for GREB1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GREB1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GREB1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GREB1 Antibody - BSA Free and earn rewards!

Have you used GREB1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies