GRPEL2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54666

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GRPEL2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GRPEL2(GrpE-like 2, mitochondrial (E. coli)) The peptide sequence was selected from the middle region of GRPEL2. Peptide sequence HEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GRPEL2 Antibody - BSA Free

Western Blot: GRPEL2 Antibody [NBP1-54666]

Western Blot: GRPEL2 Antibody [NBP1-54666]

Western Blot: GRPEL2 Antibody [NBP1-54666] - Human Heart lysate, concentration 0.2-1 ug/ml.

Applications for GRPEL2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GRPEL2

GRPEL2 is an essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. GRPEL2 seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. GRPEL2 stimulates ATPase activity of mt-HSP70. GRPEL2 may also serve to modulate the interconversion of oligomeric (inactive) and monomeric (active) forms of mt-HSP70.

Alternate Names

FLJ23713, FLJ33918, GrpE-like 2, mitochondrial (E. coli), Mt-GrpE#2mitochondrial

Gene Symbol

GRPEL2

UniProt

Q8TAA5 (Human)

Additional GRPEL2 Products

Product Documents for GRPEL2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GRPEL2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GRPEL2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GRPEL2 Antibody - BSA Free and earn rewards!

Have you used GRPEL2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies