GRSF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57316

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Western Blot, Immunoprecipitation

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GRSF1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GRSF1(G-rich RNA sequence binding factor 1) The peptide sequence was selected from the middle region of GRSF1 (NP_002083). Peptide sequence IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GRSF1 Antibody - BSA Free

Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316] - Sample Type: Jurkat Antibody Dilution: 1.0 ug/ml GRSF1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat
Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316] - Hela cell lysate, concentration 0.2-1 ug/ml.
Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Brain. Concentration 1.0ug/ml.
Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Heart. Concentration 1.0ug/ml.
Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Brain. Concentration 1.0ug/ml.
Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Liver. Concentration1.0ug/ml.
Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Lung. Concentration 1.0ug/ml.
Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316] - Jurkat. Concentration 1.0ug/ml.
Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316] - Human Fetal Liver. Concentration1.0ug/ml.
Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316] - Hela. Concentration 1.0ug/ml.
Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316]

Western Blot: GRSF1 Antibody [NBP1-57316] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml

Applications for GRSF1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GRSF1

GRSF1 is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm.The protein encoded by this gene is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.The protein encoded by this gene is a cellular protein that binds RNAs containing the G-rich element. The protein is localized in the cytoplasm, and has been shown to stimulate translation of viral mRNAs in vitro. Multiple transcript variants encoding different isoforms have been found for this gene.

Alternate Names

FLJ13125, G-rich RNA sequence binding factor 1, G-rich sequence factor 1, GRSF-1

Entrez Gene IDs

2926 (Human)

Gene Symbol

GRSF1

UniProt

Q12849 (Human)

Additional GRSF1 Products

Product Documents for GRSF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GRSF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for GRSF1 Antibody - BSA Free

Customer Reviews for GRSF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GRSF1 Antibody - BSA Free and earn rewards!

Have you used GRSF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies