GSPT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87531

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GSPT1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GSPT1. Peptide sequence: AGGRAAPVESSQEEQSLCEGSNSAVSMELSEPIENGETEMSPEESWEHKE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GSPT1 Antibody - BSA Free

Western Blot: GSPT1 Antibody [NBP2-87531]

Western Blot: GSPT1 Antibody [NBP2-87531]

Western Blot: GSPT1 Antibody [NBP2-87531] - WB Suggested Anti-GSPT1 Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole CellGSPT1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
Western Blot: GSPT1 Antibody [NBP2-87531]

Western Blot: GSPT1 Antibody [NBP2-87531]

Western Blot: GSPT1 Antibody [NBP2-87531] - Host: Rabbit. Target Name: GSPT1. Sample Tissue: Human HepG2 Whole Cell. Antibody Dilution: 1ug/ml

Applications for GSPT1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GSPT1

GSPT1 is involved in translation termination in response to the termination codons UAA, UAG and UGA. Stimulates theactivity of ERF1. Involved in regulation of mammalian cell growth

Alternate Names

ERF3A, eRF3aFLJ38048, ETF3A, eukaryotic peptide chain release factor GTP-binding subunit ERF3A, Eukaryotic peptide chain release factor subunit 3a, FLJ39067, G1 to S phase transition 1,551G9.2, G1 to S phase transition protein 1 homolog, GST1

Gene Symbol

GSPT1

Additional GSPT1 Products

Product Documents for GSPT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GSPT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GSPT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GSPT1 Antibody - BSA Free and earn rewards!

Have you used GSPT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies