GSTM2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55103

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GSTM2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GSTM2(glutathione S-transferase M2 (muscle)) The peptide sequence was selected from the N terminal of GSTM2. Peptide sequence TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GSTM2 Antibody - BSA Free

Western Blot: GSTM2 Antibody [NBP1-55103]

Western Blot: GSTM2 Antibody [NBP1-55103]

Western Blot: GSTM2 Antibody [NBP1-55103] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Immunohistochemistry-Paraffin: GSTM2 Antibody [NBP1-55103]

Immunohistochemistry-Paraffin: GSTM2 Antibody [NBP1-55103]

Immunohistochemistry-Paraffin: GSTM2 Antibody [NBP1-55103] - Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0ug/ml.
Western Blot: GSTM2 Antibody [NBP1-55103]

Western Blot: GSTM2 Antibody [NBP1-55103]

Western Blot: GSTM2 Antibody [NBP1-55103] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: Human Liver
Immunohistochemistry-Paraffin: GSTM2 Antibody [NBP1-55103]

Immunohistochemistry-Paraffin: GSTM2 Antibody [NBP1-55103]

Immunohistochemistry-Paraffin: GSTM2 Antibody [NBP1-55103] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.

Applications for GSTM2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GSTM2

At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM2 is a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs.

Alternate Names

glutathione S-transferase mu 2 (muscle), MGC117303, muscle, S-(hydroxyalkyl)glutathione lyase M2

Gene Symbol

GSTM2

UniProt

P28161 (Human)

Additional GSTM2 Products

Product Documents for GSTM2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GSTM2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GSTM2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GSTM2 Antibody - BSA Free and earn rewards!

Have you used GSTM2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies