GTF2H2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87538

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human GTF2H2. Peptide sequence: CELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGC The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for GTF2H2 Antibody - BSA Free

Western Blot: GTF2H2 Antibody [NBP2-87538]

Western Blot: GTF2H2 Antibody [NBP2-87538]

Western Blot: GTF2H2 Antibody [NBP2-87538] - Host: Rabbit. Target Name: GTF2H2. Sample Tissue: Human 293T. Antibody Dilution: 1.0ug/ml
Immunohistochemistry: GTF2H2 Antibody [NBP2-87538]

Immunohistochemistry: GTF2H2 Antibody [NBP2-87538]

Immunohistochemistry: GTF2H2 Antibody [NBP2-87538] - Human Lung

Applications for GTF2H2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GTF2H2

Initiation of transcription from protein-coding genes in eukaryotes is a complex process that requires RNA polymerase II, as well as families of basal transcription factors. Binding of the factor TFIID (TBP) to the TATA box is believed to be the first step in the formation of a multiprotein complex containing several additional factors, including TFIIA, TFIIB, TFIIE, TFIIF and TFII. TFIIH (or BTF2) is a multisubunit transcription/DNA repair factor that possesses several enzymatic activities. The core of TFIIH is composed of five subunits, designated p89 (XPB or ERCC3), p62, p52, p44 and p34. Additional subunits of the TFIIH complex are p80 (XPD or ERCC2) and the ternary kinase complex composed of Cdk7, cyclin H and MAT1. Both p89 and p80 have ATP-dependent helicase activity. The p62, p52 and p44 subunits have been shown to be involved in nucleotide excision repair.

Alternate Names

Basic transcription factor 2 44 kDa subunit, BTF2, BTF2 p44, BTF2P44TFIIH basal transcription factor complex p44 subunit, General transcription factor IIH polypeptide 2, general transcription factor IIH subunit 2, general transcription factor IIH, polypeptide 2 (44kD subunit), general transcription factor IIH, polypeptide 2, 44kD subunit, general transcription factor IIH, polypeptide 2, 44kDa, MGC102806, T-BTF2P44, TFIIH

Gene Symbol

GTF2H2

Additional GTF2H2 Products

Product Documents for GTF2H2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GTF2H2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GTF2H2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GTF2H2 Antibody - BSA Free and earn rewards!

Have you used GTF2H2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...