GTP-binding protein 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79450

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GTP-binding protein 1. Peptide Sequence ARLHGGFDSDCSEDGEALNGEPELDLTSKLVLVSPTSEQYDSLLRQMWER. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for GTP-binding protein 1 Antibody - BSA Free

Western Blot: GTP-binding protein 1 Antibody [NBP1-79450]

Western Blot: GTP-binding protein 1 Antibody [NBP1-79450]

Western Blot: GTP-binding protein 1 Antibody [NBP1-79450] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for GTP-binding protein 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GTP-binding protein 1

GTPBP1, also known as GTP-binding protein 1, is a 669 amino acid that is approx. 72 kDa, stimulates degradation of target mRNA species, binds GTP, is important for the regulation of circadian mRNA stability, and has GTPase activity. Studies on this protein have shown a relationship with the following disorders and diseases: lassa fever, fragile x syndrome, lymphocytic choriomeningitis, antiphospholipid syndrome, lupus erythematosus, adenoma, and interferon. This protein interacts with EXOSC2/RRP4, EXOSC3/RRP40, EXOSC5/RRP46, HNRNPD, HNRNPR, SYNCRIP, LRP1, SQSTM1, ABCF1, and MAP1LC3B in GTP catabolic process, positive regulation of mRNA catabolic process, signal transduction, and immune response pathways.

Alternate Names

GP1GTP-binding protein 1, GP-1MGC20069, G-protein 1, GTP binding protein 1, HSPC018

Gene Symbol

GTPBP1

Additional GTP-binding protein 1 Products

Product Documents for GTP-binding protein 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GTP-binding protein 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GTP-binding protein 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GTP-binding protein 1 Antibody - BSA Free and earn rewards!

Have you used GTP-binding protein 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...