Guanylyl Cyclase beta 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58869

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Guanylyl Cyclase beta 1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to GUCY1B3(guanylate cyclase 1, soluble, beta 3) The peptide sequence was selected from the N terminal of GUCY1B3 (NP_000848). Peptide sequence LIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVV. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Mouse reactivity reported in multiple pieces of scientific literature.

Specificity

This product is specific to Subunit or Isoform: beta-1.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

71 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Guanylyl Cyclase beta 1 Antibody - BSA Free

Western Blot: Guanylyl Cyclase beta 1 Antibody [NBP1-58869]

Western Blot: Guanylyl Cyclase beta 1 Antibody [NBP1-58869]

Western Blot: Guanylyl Cyclase beta 1 Antibody [NBP1-58869] - Fetal Brain lysates, Antibody Dilution: 0.5 ug/ml.
Western Blot: Guanylyl Cyclase beta 1 Antibody [NBP1-58869]

Western Blot: Guanylyl Cyclase beta 1 Antibody [NBP1-58869]

Western Blot: Guanylyl Cyclase beta 1 Antibody [NBP1-58869] - 293T cells lysate, concentration 0.2-1 ug/ml.

Applications for Guanylyl Cyclase beta 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Guanylyl Cyclase beta 1

Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha subunit and a beta subunit, typically GUCY1B3, catalyzes conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide (NO) and nitrovasodilator drugs (Zabel et al., 1998 [PubMed 9742212]).Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha subunit and a beta subunit, typically GUCY1B3, catalyzes conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide (NO) and nitrovasodilator drugs (Zabel et al., 1998 [PubMed 9742212]).[supplied by OMIM].

Alternate Names

EC 4.6.1.2, GC-SB3, GCS-beta-1, GCS-beta-3, guanylate cyclase 1, soluble, beta 3, guanylate cyclase soluble subunit beta-1, Guanylate cyclase soluble subunit beta-3, GUC1B3GUCB3, GUCSB3GC-S-beta-1, GUCY1B1, Soluble guanylate cyclase small subunit

Entrez Gene IDs

2983 (Human)

Gene Symbol

GUCY1B1

UniProt

Q02153 (Human)

Additional Guanylyl Cyclase beta 1 Products

Product Documents for Guanylyl Cyclase beta 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Guanylyl Cyclase beta 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Guanylyl Cyclase beta 1 Antibody - BSA Free

Customer Reviews for Guanylyl Cyclase beta 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Guanylyl Cyclase beta 1 Antibody - BSA Free and earn rewards!

Have you used Guanylyl Cyclase beta 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies