H4 Clustered Histone 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09734

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all H4 Clustered Histone 1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human H4 Clustered Histone 1 (NP_778224). Peptide sequence LGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for H4 Clustered Histone 1 Antibody - BSA Free

Western Blot: H4 Clustered Histone 1 Antibody [NBP3-09734]

Western Blot: H4 Clustered Histone 1 Antibody [NBP3-09734]

Western Blot: H4 Clustered Histone 1 Antibody [NBP3-09734] - Western blot analysis of H4 Clustered Histone 1 in 293T Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for H4 Clustered Histone 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: H4 Clustered Histone 1

Alternate Names

H4-16;H4C11;H4C12;H4C13;H4C14;H4C15;H4C2;H4C3;H4C4;H4C5;H4C6;H4C8;H4C9;H4FA, H4F4, HIST1H4A

Gene Symbol

H4C1

Additional H4 Clustered Histone 1 Products

Product Documents for H4 Clustered Histone 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for H4 Clustered Histone 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for H4 Clustered Histone 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review H4 Clustered Histone 1 Antibody - BSA Free and earn rewards!

Have you used H4 Clustered Histone 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies