HACE1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10567

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human HACE1 (NP_065822). Peptide sequence RARTVELPEDNETAVYTLMPMVMADQHRSVSELLSNSKFDVNYAFGRVKR

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HACE1 Antibody - BSA Free

Western Blot: HACE1 Antibody [NBP3-10567]

Western Blot: HACE1 Antibody [NBP3-10567]

Western Blot: HACE1 Antibody [NBP3-10567] - Western blot analysis of HACE1 in OVCAR-3 Whole cell lysates. Antibody dilution at 1.0ug/ml

Applications for HACE1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HACE1

The HACE1 gene codes for a E3 ubiquitin-protein ligase HACE1 that is a participant in Golgi membrane fusion as well as in regulation of small GTPases to mediate ubiquitination and degradation of active RAC1, working in defense against pathogens. This protein may also play a role as a transcription regulator through its interaction with RARB. HACE1 exists in four isoforms: isoform 1 is 909 amino acids long, 102 kDA; isoform 2 is 318 amino acids long, 35 kDA; isoform 3 is 562 amino acids long, 63 kDA; isoform 4 is 694 amino acids long, nearly 78 kDA. HACE1 has been researched in regards to celiac disease, malaria, colorectal cancer, wilms tumors, and carcinoma. It is involved in the SMAD signaling network as well as ubiquitin-proteasome dependent proteolysis and has been known to interact with genes RARA, RAB4A, RAC1, PLXNA2, and IRF7.

Alternate Names

E3 ubiquitin-protein ligase HACE1, EC 6.3.2, HACE, HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1, HECT domain and ankyrin repeat-containing E3 ubiquitin-protein ligase 1, KIAA1320EC 6.3.2.-

Gene Symbol

HACE1

Additional HACE1 Products

Product Documents for HACE1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HACE1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HACE1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HACE1 Antibody - BSA Free and earn rewards!

Have you used HACE1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...