HADHA Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87551

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HADHA. Peptide sequence: IYQEGVKRKDLNSDMDSILASLKLPPKSEVSSDEDIQFRLVTRFVNEAVM The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HADHA Antibody - BSA Free

Western Blot: HADHA Antibody [NBP2-87551]

Western Blot: HADHA Antibody [NBP2-87551]

Western Blot: HADHA Antibody [NBP2-87551] - Host: Rabbit. Target Name: HADHA. Sample Tissue: Human DLD1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for HADHA Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HADHA

HADHA encodes the alpha subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the alpha subunit catalyzing the 3-hydroxyacyl-CoA dehydrogenase and enoyl-CoA hydratase activities. Mutations in this gene result in trifunctional protein deficiency or LCHAD deficiency. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation.

Alternate Names

3-ketoacyl-Coenzyme A (CoA) thiolase, alpha subunit, 3-oxoacyl-CoA thiolase, 78 kDa gastrin-binding protein, ECHA, gastrin-binding protein, GBP, HADH, hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), alpha subunit, hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), alpha subunit, LCEH, LCHAD, long-chain 2-enoyl-CoA hydratase, long-chain-3-hydroxyacyl-CoA dehydrogenase, MGC1728, mitochondrial long-chain 2-enoyl-Coenzyme A (CoA) hydratase, alpha subunit, mitochondrial long-chain L-3-hydroxyacyl-Coenzyme A (CoA) dehydrogenase, alphasubunit, mitochondrial trifunctional enzyme, alpha subunit, mitochondrial trifunctional protein, alpha subunit, MTPATP-ALPHA, TP-alpha, trifunctional enzyme subunit alpha, mitochondrial

Gene Symbol

HADHA

Additional HADHA Products

Product Documents for HADHA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HADHA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HADHA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HADHA Antibody - BSA Free and earn rewards!

Have you used HADHA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...