HCFC1R1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-53070

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HCFC1R1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to HCFC1R1(host cell factor C1 regulator 1 (XPO1 dependent)) The peptide sequence was selected from the middle region of HCFC1R1. Peptide sequence LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

15 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HCFC1R1 Antibody - BSA Free

Western Blot: HCFC1R1 Antibody [NBP1-53070]

Western Blot: HCFC1R1 Antibody [NBP1-53070]

Western Blot: HCFC1R1 Antibody [NBP1-53070] - Human Spleen lysate, concentration 0.2-1 ug/ml.

Applications for HCFC1R1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HCFC1R1

HCFC1R1 regulates HCFC1 activity by modulating its subcellular localization. Overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. HCFC1R1-mediated export may provide the pool of cytoplasmic HCFC1 required for import of virion-derived VP16 into the nucleus.

Alternate Names

FLJ20568, HCF-1 beta-propeller interacting protein, HCF-1 beta-propeller-interacting protein, host cell factor C1 regulator 1, host cell factor C1 regulator 1 (XPO1 dependant), host cell factor C1 regulator 1 (XPO1 dependent), HPIPMGC99622, MGC70711

Gene Symbol

HCFC1R1

UniProt

Q9NWW0 (Human)

Additional HCFC1R1 Products

Product Documents for HCFC1R1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HCFC1R1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HCFC1R1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HCFC1R1 Antibody - BSA Free and earn rewards!

Have you used HCFC1R1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies