Hemicentin 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09735

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Hemicentin 2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human Hemicentin 2. Peptide sequence XPPSIREDGRKANVSGMAGQSLTLECDANGFPVPEIVWLKDAQLIPKVGG

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Hemicentin 2 Antibody - BSA Free

Western Blot: Hemicentin 2 Antibody [NBP3-09735]

Western Blot: Hemicentin 2 Antibody [NBP3-09735]

Western Blot: Hemicentin 2 Antibody [NBP3-09735] - Western blot analysis of Hemicentin 2 in 721_B Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for Hemicentin 2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Hemicentin 2

The HMCN2 (Hemicentin 2) gene encodes a Hemicentin-2 protein that in isoform 1 is 5,065 amino acids long, 542 kDA, in isoform 2 is 4,198 amino acids long, 448 kDA, and in isoform 3 is 4,427 amino acids long at 474 kDA.

Alternate Names

hemicentin-2

Gene Symbol

HMCN2

Additional Hemicentin 2 Products

Product Documents for Hemicentin 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Hemicentin 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Hemicentin 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Hemicentin 2 Antibody - BSA Free and earn rewards!

Have you used Hemicentin 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies