HEMK2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56486

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HEMK2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to N6AMT1(N-6 adenine-specific DNA methyltransferase 1 (putative)) The peptide sequence was selected from the N terminal of N6AMT1. Peptide sequence MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HEMK2 Antibody - BSA Free

Western Blot: HEMK2 Antibody [NBP1-56486]

Western Blot: HEMK2 Antibody [NBP1-56486]

Western Blot: HEMK2 Antibody [NBP1-56486] - NCI-H226 cell lysate, Antibody Titration: 0.2-1 ug/ml
Western Blot: HEMK2 Antibody [NBP1-56486]

Western Blot: HEMK2 Antibody [NBP1-56486]

Western Blot: HEMK2 Antibody [NBP1-56486] - Mouse Brain lysate, concentration 5% Milk.

Applications for HEMK2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HEMK2

The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Alternate Names

C21orf127, chromosome 21 open reading frame 127, EC 2.1.1.-, HemK methyltransferase family member 2, HEMK2, m.HsaHemK2P, MGC19995, MTQ2, N(6)-adenine-specific DNA methyltransferase 1, N-6 adenine-specific DNA methyltransferase 1 (putative), N6AMT, N6-DNA-methyltransferase, PRED28

Gene Symbol

HEMK2

UniProt

Q96F73 (Human)

Additional HEMK2 Products

Product Documents for HEMK2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HEMK2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HEMK2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HEMK2 Antibody - BSA Free and earn rewards!

Have you used HEMK2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies