HES6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87564

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all HES6 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse HES6. Peptide sequence: LLAGTEVQAKLENAEVLELTVRRVQGALRGRAREREQLQAEASERFAAGY The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HES6 Antibody - BSA Free

Western Blot: HES6 Antibody [NBP2-87564]

Western Blot: HES6 Antibody [NBP2-87564]

Western Blot: HES6 Antibody [NBP2-87564] - WB Suggested Anti-Hes6 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Stomach

Applications for HES6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HES6

HES6 is a transcription cofactor that itself does not bind to DNA but suppresses both HES1-mediated N box-dependent transcriptional repression and binding of HES1 to E box sequences. It also suppresses HES1-mediated inhibition of the heterodimer formed by ASCL1/MASH1 and TCFEA2/E47, allowing ASCL1 and TCFEA2 to upregulate transcription in its presence. HES6 appears to have novel functions in tumor and cancer cell lines, although these have not yet been elucidated fully.

Alternate Names

BHLHB41, bHLHb41Class B basic helix-loop-helix protein 41, bHLHc23, C-HAIRY1, Hairy and enhancer of split 6, hairy and enhancer of split 6 (Drosophila), HES-6, transcription cofactor HES-6

Gene Symbol

HES6

Additional HES6 Products

Product Documents for HES6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HES6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HES6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HES6 Antibody - BSA Free and earn rewards!

Have you used HES6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies