HEXB Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49211

Novus Biologicals
Loading...

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: FGFYKWHHEPAEFQAKTQVQQLLVSITLQSECDAFPNISSDESYTLLVKEPVAVLKANRVW

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HEXB Antibody - BSA Free

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211]

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211]

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211] - Staining of human prostate shows moderate to strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211]

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211]

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211] - Staining of human epididymis shows granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211]

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211]

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211] - Staining of human colon, epididymis, kidney and liver using Anti-HEXB antibody NBP2-49211 (A) shows similar protein distribution across tissues to independent antibody NBP2-48689 (B).
Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211]

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211]

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211]

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211]

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211] - Staining of human colon.
Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211]

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211]

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211] - Staining of human gastrointestinal shows moderate to strong granular cytoplasmic positivity in cells in lamina propria.
Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211]

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211]

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211] - Staining of human liver shows very weak granular cytoplasmic positivity in hepatocytes.

Applications for HEXB Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 1 using NBP2-49211 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Hexosaminidase B/HEXB

HEXB, also known as Beta-hexosaminidase subunit beta, is a 556 amino acid that is 63 kDa, lysosome located, composed of two subunits, alpha and beta, which are encoded by separate gene, and in control of the degradation of GM2 gangliosides and other molecules containing terminal N-acetyl hexosamines, in the brain and other tissues. Current research is being performed on several diseases and disorders including gangliosidosis, sandhoff disease, infantile, juvenile, and adult forms, tay-sachs disease, neuronitis, lysosomal storage disease, motor neuron disease, cervical cancer, mucopolysaccharidosis, cervicitis, neurodegenerative disease, recurrent respiratory papillomatosis, hairy cell leukemia, macrocephaly, autonomic dysfunction, cholesteatoma, type 2 diabetes mellitus, rheumatoid arthritis, and diarrhea. The protein has been linked to pathways such as glycan degradation, amino sugar and nucleotide sugar metabolism, glycosaminoglycan degradation, glycosphingolipid biosynthesis - globo series, glycosphingolipid biosynthesis - ganglio series, MPS VI - Maroteaux-Lamy syndrome, metabolic pathways, and lysosome pathways where it interacts with EIF2D, GYG1, CSNK2B, CHIA,CHIT1, and CHIT1 proteins.

Alternate Names

ENC-1AS, HCC-7, HEL-248, HEXB

Gene Symbol

HEXB

Additional Hexosaminidase B/HEXB Products

Product Documents for HEXB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HEXB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HEXB Antibody - BSA Free (1)

1 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
100%

Have you used HEXB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • HEXB Antibody
    Name: Anonymous
    Application: Immunohistochemistry-Frozen
    Sample Tested: mouse spinal cord
    Species: Mouse
    Verified Customer | Posted 06/20/2023
    Mouse Spinal Cord (HexB NBP2-49211)
    HEXB Antibody - BSA Free NBP2-49211
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...