HEXO Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57118

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HEXO Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to THEX1(three prime histone mRNA exonuclease 1) The peptide sequence was selected from the N terminal of THEX1. Peptide sequence SKFITSSASDFSDPVYKEIAITNGCINRMSKEELRAKLSEFKLETRGVKD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HEXO Antibody - BSA Free

Western Blot: HEXO Antibody [NBP1-57118]

Western Blot: HEXO Antibody [NBP1-57118]

Western Blot: HEXO Antibody [NBP1-57118] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Applications for HEXO Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HEXO

THEX1 contains 1 SAP domain and 1 exonuclease domain. It is an RNA exonuclease that binds to the 3' end of histone mRNAs and probably degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. It is also able to degrade the 3' overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi).

Alternate Names

3' exoribonuclease, 3'-5' exonuclease ERI1, 3'EXO, 3'HEXO, EC 3.1, enhanced RNAi three prime mRNA exonuclease homolog 1, Eri-1 homolog, exoribonuclease 1, HEXO, histone mRNA 3' end-specific exonuclease, Histone mRNA 3'-end-specific exoribonuclease, Histone mRNA 3'-exonuclease 1, MGC35395, Protein 3'hExo, THEX1, three prime histone mRNA exonuclease 1,3'-5' exoribonuclease 1, three prime mRNA exonuclease 1

Gene Symbol

ERI1

UniProt

Q8IV48 (Human)

Additional HEXO Products

Product Documents for HEXO Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HEXO Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HEXO Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HEXO Antibody - BSA Free and earn rewards!

Have you used HEXO Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies