hHpr1-p84-Thoc1 Antibody (6E3A7)

Novus Biologicals | Catalog # NBP3-16800

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6E3A7 expressed in HEK293
View all hHpr1-p84-Thoc1 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 350-450 of human hHpr1-p84-Thoc1 (NP_005122.2). SLWIEDTTKSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERTSDTKPTRIIRKRTAPEDFLGKGPTKKILMGNEELTRLWNLCPDNME

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for hHpr1-p84-Thoc1 Antibody (6E3A7)

Western Blot: hHpr1-p84-Thoc1 Antibody (6E3A7) [NBP3-16800]

Western Blot: hHpr1-p84-Thoc1 Antibody (6E3A7) [NBP3-16800]

Western Blot: hHpr1-p84-Thoc1 Antibody (6E3A7) [NBP3-16800] - Western blot analysis of extracts of various cell lines, using hHpr1-p84-Thoc1 (THOC1) Rabbit mAb (NBP3-16800) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Applications for hHpr1-p84-Thoc1 Antibody (6E3A7)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: hHpr1-p84-Thoc1

P84/N5-5E10 recognizes an 84kDa nuclear matrix protein. Initially isolated by its interaction with the amino terminal region of the retinoblastoma protein, it has been used extensively as a nuclear-specific marker in both immunofluorescence and cell fractionation studies.

Alternate Names

HPR1THO complex subunit 1, hTREX84, Nuclear matrix protein p84, P84, P84N5, THO complex 1, Tho1

Gene Symbol

THOC1

Additional hHpr1-p84-Thoc1 Products

Product Documents for hHpr1-p84-Thoc1 Antibody (6E3A7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for hHpr1-p84-Thoc1 Antibody (6E3A7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for hHpr1-p84-Thoc1 Antibody (6E3A7)

There are currently no reviews for this product. Be the first to review hHpr1-p84-Thoc1 Antibody (6E3A7) and earn rewards!

Have you used hHpr1-p84-Thoc1 Antibody (6E3A7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies