HIP1 Related Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87567

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all HIP1 Related Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human HIP1 Related. Peptide sequence: RLQECSRTVNERAANVVASTKSGQEQIEDRDTMDFSGLSLIKLKKQEMET The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HIP1 Related Antibody - BSA Free

Western Blot: HIP1 Related Antibody [NBP2-87567]

Western Blot: HIP1 Related Antibody [NBP2-87567]

Western Blot: HIP1 Related Antibody [NBP2-87567] - Host: Rabbit. Target Name: HIP1R. Sample Tissue: Human Mesenchymoma Tumor lysates. Antibody Dilution: 1ug/ml

Applications for HIP1 Related Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HIP1 Related

Huntingtin Interacting Protein (HIP1) is a reportedly proapoptotic, cargo-specific adaptor protein that may be involved in the pathogenesis of Huntingtin's disease. Huntingtin's is a neurodegenerate disease caused by the expansion of a polymorphic glutamine tract in Huntingtin.

In addition to playing a role in Huntingtin disease, HIP1 is likely to be involved in the recruitment of clathrin coats to lipid membranes, and it may also factor in tumorigenesis by allowing the survival of precancerous and cancerous cells. Since HIP-1 expression is significantly associated with prostate and colon cancer metastasis, HIP-1 can serve as a putative prognostic factor for prostate and colon cancers.

Alternate Names

FLJ14000, HIP-12, HIP12HIP1-related protein, HIP3, huntingtin interacting protein 1 related, huntingtin interacting protein 12, Huntingtin-interacting protein 12, huntingtin-interacting protein 1-related protein, ILWEQ, KIAA0655FLJ27022, MGC47513

Gene Symbol

HIP1R

Additional HIP1 Related Products

Product Documents for HIP1 Related Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HIP1 Related Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HIP1 Related Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HIP1 Related Antibody - BSA Free and earn rewards!

Have you used HIP1 Related Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies