HIP1 Related Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-87567
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human HIP1 Related. Peptide sequence: RLQECSRTVNERAANVVASTKSGQEQIEDRDTMDFSGLSLIKLKKQEMET The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for HIP1 Related Antibody - BSA Free
Western Blot: HIP1 Related Antibody [NBP2-87567]
Western Blot: HIP1 Related Antibody [NBP2-87567] - Host: Rabbit. Target Name: HIP1R. Sample Tissue: Human Mesenchymoma Tumor lysates. Antibody Dilution: 1ug/mlApplications for HIP1 Related Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: HIP1 Related
In addition to playing a role in Huntingtin disease, HIP1 is likely to be involved in the recruitment of clathrin coats to lipid membranes, and it may also factor in tumorigenesis by allowing the survival of precancerous and cancerous cells. Since HIP-1 expression is significantly associated with prostate and colon cancer metastasis, HIP-1 can serve as a putative prognostic factor for prostate and colon cancers.
Alternate Names
FLJ14000, HIP-12, HIP12HIP1-related protein, HIP3, huntingtin interacting protein 1 related, huntingtin interacting protein 12, Huntingtin-interacting protein 12, huntingtin-interacting protein 1-related protein, ILWEQ, KIAA0655FLJ27022, MGC47513
Gene Symbol
HIP1R
Additional HIP1 Related Products
Product Documents for HIP1 Related Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for HIP1 Related Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for HIP1 Related Antibody - BSA Free
There are currently no reviews for this product. Be the first to review HIP1 Related Antibody - BSA Free and earn rewards!
Have you used HIP1 Related Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...