Histamine H4R Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-03549

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Histamine H4R Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 194-304 of human Histamine H4R (NP_067637.2). NMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARRLAKS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Histamine H4R Antibody - BSA Free

Western Blot: Histamine H4R AntibodyBSA Free [NBP3-03549]

Western Blot: Histamine H4R AntibodyBSA Free [NBP3-03549]

Western Blot: Histamine H4R Antibody [NBP3-03549] - Analysis of extracts of various cell lines, using Histamine H4R antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

Applications for Histamine H4R Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:1000-1:4000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Histamine H4R

Histamine Receptor H4 binds histamine and several psychoactive compounds such as amitriptyline, chlorpromazine, cyproheptadine, and mianserin. The Histamine H4 receptor has been reported in human blood peripheral leukocytes, bone marrow, colon, liver, lung, smalll intestine, spleen, testis, thymus, tonsil, and trachea. Contrary to the mouse H4 receptor, the human gene was not detected in brain.

Long Name

Histamine H4 Receptor

Alternate Names

AXOR35, BG26, GPCR105, GPRv53, HH4R, Histamine H4 R, HRH4, Pfi-013, SP9144

Gene Symbol

HRH4

Additional Histamine H4R Products

Product Documents for Histamine H4R Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Histamine H4R Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Histamine H4R Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Histamine H4R Antibody - BSA Free and earn rewards!

Have you used Histamine H4R Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies