Histamine N-Methyltransferase/HNMT Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69134

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Histamine N-Methyltransferase/HNMT Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to HNMT (histamine N-methyltransferase) The peptide sequence was selected from the N terminal of HNMT. Peptide sequence PGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Histamine N-Methyltransferase/HNMT Antibody - BSA Free

Western Blot: Histamine N-Methyltransferase/HNMT Antibody [NBP1-69134]

Western Blot: Histamine N-Methyltransferase/HNMT Antibody [NBP1-69134]

Western Blot: HNMT Antibody [NBP1-69134] - Human Heart lysate, concentration 0.2-1 ug/ml.

Applications for Histamine N-Methyltransferase/HNMT Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Histamine N-Methyltransferase/HNMT

In mammals, histamine is metabolized by two major pathways: N(tau)-methylation via histamine N-methyltransferase and oxidative deamination via diamine oxidase. This gene encodes the first enzyme which is found in the cytosol and uses S-adenosyl-L-methionine as the methyl donor. In the mammalian brain, the neurotransmitter activity of histamine is controlled by N(tau)-methylation as diamine oxidase is not found in the central nervous system. A common genetic polymorphism affects the activity levels of this gene product in red blood cells. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene.

Long Name

Histamine N-Methyltransferase

Alternate Names

Histamine NMethyltransferase, HMT, HNMT, HNMT-S1, HNMT-S2

Gene Symbol

HNMT

UniProt

P50135 (Human)

Additional Histamine N-Methyltransferase/HNMT Products

Product Documents for Histamine N-Methyltransferase/HNMT Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Histamine N-Methyltransferase/HNMT Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Histamine N-Methyltransferase/HNMT Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Histamine N-Methyltransferase/HNMT Antibody - BSA Free and earn rewards!

Have you used Histamine N-Methyltransferase/HNMT Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies