HIV-1 Rev binding protein Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57277

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to HIV-1 Rev binding protein. The peptide sequence was selected from the middle region of HRB. Peptide sequence SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HIV-1 Rev binding protein Antibody - BSA Free

Western Blot: HIV-1 Rev binding protein Antibody [NBP1-57277]

Western Blot: HIV-1 Rev binding protein Antibody [NBP1-57277]

Western Blot: HIV-1 Rev binding protein Antibody [NBP1-57277] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Western Blot: HIV-1 Rev binding protein Antibody [NBP1-57277]

Western Blot: HIV-1 Rev binding protein Antibody [NBP1-57277]

Western Blot: HIV-1 Rev binding protein Antibody [NBP1-57277] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: HIV-1 Rev binding protein Antibody [NBP1-57277]

Western Blot: HIV-1 Rev binding protein Antibody [NBP1-57277]

Western Blot: HIV-1 Rev binding protein Antibody [NBP1-57277] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Western Blot: HIV-1 Rev binding protein Antibody [NBP1-57277]

Western Blot: HIV-1 Rev binding protein Antibody [NBP1-57277]

Western Blot: HIV-1 Rev binding protein Antibody [NBP1-57277] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Applications for HIV-1 Rev binding protein Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HIV-1 Rev binding protein

HRB is related to nucleoporins, a class of proteins that mediate nucleocytoplasmic transport. HRB binds the activation domain of the human immunodeficiency virus Rev protein when Rev is assembled onto its RNA target, and is required for the nuclear export of Rev-directed RNAs.The protein encoded by this gene is related to nucleoporins, a class of proteins that mediate nucleocytoplasmic transport. This encoded protein binds the Rev activation domain when Rev is assembled onto its RNA target and can significantly enhance Rev activity when overexpressed. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

ArfGAP with FG repeats 1, DKFZp686I15205, HIV-1 Rev-binding protein, HRBRev interacting protein, Rab, Rev/Rex activation domain-binding protein, RABMGC116938, RIPMGC116940

Gene Symbol

AGFG1

UniProt

Additional HIV-1 Rev binding protein Products

Product Documents for HIV-1 Rev binding protein Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HIV-1 Rev binding protein Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HIV-1 Rev binding protein Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HIV-1 Rev binding protein Antibody - BSA Free and earn rewards!

Have you used HIV-1 Rev binding protein Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...