HIVEP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83047

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all HIVEP1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human HIVEP1. Peptide sequence: FSYERSGYDLEESDGPDEDDNENEDDDEDSQAESVLSATPSVTASPQHLP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HIVEP1 Antibody - BSA Free

Western Blot: HIVEP1 Antibody [NBP2-83047]

Western Blot: HIVEP1 Antibody [NBP2-83047]

Western Blot: HIVEP1 Antibody [NBP2-83047] - Host: Rabbit. Target Name: HIVEP1. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for HIVEP1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HIVEP1

Members of the ZAS family, such as ZAS1 (HIVEP1), are large proteins that contain a ZAS domain, a modular protein structure consisting of a pair of C2H2 zinc fingers with an acidic-rich region and a serine/threonine-rich sequence. These proteins bind specific DNA sequences, including the kappa-B motif (GGGACTTTCC), in the promoters and enhancer regions of several genes and viruses, including human immunodeficiency virus (HIV). ZAS genes span more than 150 kb and contain at least 10 exons, one of which is longer than 5.5 kb (Allen and Wu, 2004).(supplied by OMIM)

Alternate Names

CIRIP, CRYBP1, human immunodeficiency virus type I enhancer binding protein 1, MBP-1, PRDII-BF1, Schnurri-1, ZAS1, zinc finger protein 40, ZNF40, ZNF40A

Gene Symbol

HIVEP1

Additional HIVEP1 Products

Product Documents for HIVEP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HIVEP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HIVEP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HIVEP1 Antibody - BSA Free and earn rewards!

Have you used HIVEP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies