HLA A Antibody - Azide and BSA Free

Novus Biologicals | Catalog # H00003105-B01P

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Flow Cytometry

Label

Unconjugated

Antibody Source

Polyclonal Mouse IgG

Format

Azide and BSA Free
View all HLA A Primary Antibodies »

Product Specifications

Immunogen

HLA-A (NP_002107.3, 1 a.a. - 365 a.a.) full-length human protein. MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV

Specificity

HLA-A - major histocompatibility complex, class I, A,

Clonality

Polyclonal

Host

Mouse

Isotype

IgG

Description

Quality control test: Antibody reactive against mammalian transfected lysate.

Scientific Data Images for HLA A Antibody - Azide and BSA Free

Western Blot: HLA A Antibody [H00003105-B01P]

Western Blot: HLA A Antibody [H00003105-B01P]

Western Blot: HLA A Antibody [H00003105-B01P] - Analysis of HLA-A expression in human spleen.
Flow Cytometry: HLA A Antibody [H00003105-B01P]

Flow Cytometry: HLA A Antibody [H00003105-B01P]

Flow Cytometry: HLA A Antibody [H00003105-B01P] - Analysis of negative control 293 cells (Black) and HLA-A expressing 293 cells (Green) using HLA-A purified mouse polyclonal antibody.
Western Blot: HLA A Antibody [H00003105-B01P]

Western Blot: HLA A Antibody [H00003105-B01P]

Western Blot: HLA A Antibody [H00003105-B01P] - analysis of HLA-A expression in transfected 293T cell line by HLA-A purified MaxPab polyclonal antibody (B01P). Lane 1: HLA-A transfected lysate (40.80 KDa). Lane 2: Non-transfected lysate.
Western Blot: HLA A Antibody [H00003105-B01P]

Western Blot: HLA A Antibody [H00003105-B01P]

Western Blot: HLA A Antibody [H00003105-B01P] - Analysis of HLA-A expression in A-431.
Western Blot: HLA A Antibody [H00003105-B01P]

Western Blot: HLA A Antibody [H00003105-B01P]

Western Blot: HLA A Antibody [H00003105-B01P] - Analysis of HLA-A expression in transfected 293T cell line by HLA-A polyclonal antibody. Lane 1: HLA-A transfected lysate(40.15 KDa). Lane 2: Non-transfected lysate.

Applications for HLA A Antibody - Azide and BSA Free

Application
Recommended Usage

Flow Cytometry

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against transfected lysate and tissue lysate for WB. It has been used for ELISA. and FACS.

Flow Cytometry Panel Builder

Bio-Techne Knows Flow Cytometry

Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.

Advanced Features

  • Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
  • Spillover Popups - Visualize the spectra of individual fluorochromes
  • Antigen Density Selector - Match fluorochrome brightness with antigen density
Build Your Panel Now
Flow Cytometry

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

PBS (pH 7.4)

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: HLA A

HLA-A belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-A alleles have been described. [provided by RefSeq]

Alternate Names

A-10 alpha chain, FLJ26655, HLA class I histocompatibility antigen, A-1 alpha chain, HLA class I histocompatibility antigen, A-28 alpha chain, HLA class I histocompatibility antigen, A-9 alpha chain, HLAA, major histocompatibility complex, class I, A, MHC class I antigen A*1, MHC class I antigen A*11, MHC class I antigen A*80

Gene Symbol

HLA-A

UniProt

NP_002107.3 (Human)

Additional HLA A Products

Product Documents for HLA A Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HLA A Antibody - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HLA A Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review HLA A Antibody - Azide and BSA Free and earn rewards!

Have you used HLA A Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies