HMBOX1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87578

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human HMBOX1. Peptide sequence: ETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HMBOX1 Antibody - BSA Free

Western Blot: HMBOX1 Antibody [NBP2-87578]

Western Blot: HMBOX1 Antibody [NBP2-87578]

Western Blot: HMBOX1 Antibody [NBP2-87578] - WB Suggested Anti-HMBOX1 Antibody Titration: 2.5ug/ml. ELISA Titer: 1:312500. Positive Control: Jurkat cell lysate
Western Blot: HMBOX1 Antibody [NBP2-87578]

Western Blot: HMBOX1 Antibody [NBP2-87578]

Western Blot: HMBOX1 Antibody [NBP2-87578] - Host: Mouse. Target Name: HMBOX1. Sample Tissue: Mouse Brain. Antibody Dilution: 1ug/ml

Applications for HMBOX1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HMBOX1

HMBOX1, also known as Homeobox-containing protein 1, is a 47kDa 429 amino acid protein with four isoforms produced by alternative splicing. The gene can be found in the nucleus and the cytoplasm where it acts as a transcriptional repressor. Current research on HMBOX1 is being conducted in relation to bronchopulmonary dysplasia, immunodeficiency and prostatitis. HMBOX1 is linked to the MRNA splicing, nuclear transport, stem cell differentiation, tube formation and transport pathways where it interacts with SUMO2 and ENTPD2.

Alternate Names

FLJ21616, HNF1LA, homeobox containing 1, homeobox-containing protein 1, homeobox-containing protein PBHNF, PBHNF

Gene Symbol

HMBOX1

Additional HMBOX1 Products

Product Documents for HMBOX1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HMBOX1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HMBOX1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HMBOX1 Antibody - BSA Free and earn rewards!

Have you used HMBOX1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...