HMBS Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56412

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HMBS Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to HMBS(hydroxymethylbilane synthase) The peptide sequence was selected from the N terminal of HMBS. Peptide sequence MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HMBS Antibody - BSA Free

Western Blot: HMBS Antibody [NBP1-56412]

Western Blot: HMBS Antibody [NBP1-56412]

Western Blot: HMBS Antibody [NBP1-56412] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Applications for HMBS Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HMBS

HMBS is a member of the hydroxymethylbilane synthase superfamily. It is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. Mutations in this gene are associated with the autosomal dominant disease acute intermittent porphyria.This gene encodes a member of the hydroxymethylbilane synthase superfamily. The encoded protein is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. Mutations in this gene are associated with the autosomal dominant disease acute intermittent porphyria. Alternatively spliced transcript variants encoding different isoforms have been described.

Alternate Names

hydroxymethylbilane synthasePre-uroporphyrinogen synthase, PBGDPBG-D, PORC, porphobilinogen deaminase, porphyria, acute; Chester type, UPSEC 2.5.1.61, uroporphyrinogen I synthase, uroporphyrinogen I synthetase

Gene Symbol

HMBS

UniProt

P08397 (Human)

Additional HMBS Products

Product Documents for HMBS Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HMBS Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HMBS Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HMBS Antibody - BSA Free and earn rewards!

Have you used HMBS Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies