hnRNP G Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79904

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The specific Immunogen is proprietary information. Peptide sequence SSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for hnRNP G Antibody - BSA Free

Western Blot: hnRNP G Antibody [NBP1-79904]

Western Blot: hnRNP G Antibody [NBP1-79904]

Western Blot: hnRNP G Antibody [NBP1-79904] - Hela, Antibody Dilution: 1.0 ug/ml RBMX is supported by BioGPS gene expression data to be expressed in HeLa.
Western Blot: hnRNP G Antibody [NBP1-79904]

Western Blot: hnRNP G Antibody [NBP1-79904]

Western Blot: hnRNP G Antibody [NBP1-79904] - Titration: 1.0 ug/ml Positive Control: OVCAR-3 Whole Cell.

Applications for hnRNP G Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: hnRNP G

Heterogeneous nuclear ribonucleoproteins (hnRNPs) constitute a set of polypeptides that contribute to mRNA transcription, pre-mRNA processing as well as mature mRNA transport to the cytoplasm and translation. They also bind heterogeneous nuclear RNA (hnRNA), which are the transcripts produced by RNA polymerase II. There are approximately 20 known hnRNP proteins, and their complexes are the major constituents of the spliceosome. The majority of hnRNP proteins components are localized to the nucleus; however some shuttle between the nucleus and the cytoplasm. hnRNP G is a glycoprotein, which was originally identified as an autoantigen from German shepherd dogs with lupus-like syndrome. The gene encoding hnRNP G is located on chromosome Xq26 and is ubiquitously expressed. It contains one RNP-consensus RNA binding domain (RBD) and is related to RBMY, which is involved in spermatogenesis, and hnRNP G-T, which is a testis specific protein. All three proteins interact with Tra2b and therefore, are involved in pre-mRNA splicing.

Alternate Names

Glycoprotein p43, heterogeneous nuclear ribonucleoprotein G, hnRNP G, hnRNP-G, HNRPG, RBMXP1, RBMXRT, RNA binding motif protein, X chromosome, RNA binding motif protein, X-linked, RNA-binding motif protein, X chromosome, RNMX

Gene Symbol

RBMX

Additional hnRNP G Products

Product Documents for hnRNP G Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for hnRNP G Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for hnRNP G Antibody - BSA Free

There are currently no reviews for this product. Be the first to review hnRNP G Antibody - BSA Free and earn rewards!

Have you used hnRNP G Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...