hnRNP G Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03550

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all hnRNP G Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human hnRNP G (NP_002130.2). MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for hnRNP G Antibody - Azide and BSA Free

Western Blot: hnRNP G AntibodyAzide and BSA Free [NBP3-03550]

Western Blot: hnRNP G AntibodyAzide and BSA Free [NBP3-03550]

Western Blot: hnRNP G Antibody [NBP3-03550] - Analysis of extracts of various cell lines, using hnRNP G antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit.

Applications for hnRNP G Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: hnRNP G

Heterogeneous nuclear ribonucleoproteins (hnRNPs) constitute a set of polypeptides that contribute to mRNA transcription, pre-mRNA processing as well as mature mRNA transport to the cytoplasm and translation. They also bind heterogeneous nuclear RNA (hnRNA), which are the transcripts produced by RNA polymerase II. There are approximately 20 known hnRNP proteins, and their complexes are the major constituents of the spliceosome. The majority of hnRNP proteins components are localized to the nucleus; however some shuttle between the nucleus and the cytoplasm. hnRNP G is a glycoprotein, which was originally identified as an autoantigen from German shepherd dogs with lupus-like syndrome. The gene encoding hnRNP G is located on chromosome Xq26 and is ubiquitously expressed. It contains one RNP-consensus RNA binding domain (RBD) and is related to RBMY, which is involved in spermatogenesis, and hnRNP G-T, which is a testis specific protein. All three proteins interact with Tra2b and therefore, are involved in pre-mRNA splicing.

Alternate Names

Glycoprotein p43, heterogeneous nuclear ribonucleoprotein G, hnRNP G, hnRNP-G, HNRPG, RBMXP1, RBMXRT, RNA binding motif protein, X chromosome, RNA binding motif protein, X-linked, RNA-binding motif protein, X chromosome, RNMX

Gene Symbol

RBMX

Additional hnRNP G Products

Product Documents for hnRNP G Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for hnRNP G Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for hnRNP G Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review hnRNP G Antibody - Azide and BSA Free and earn rewards!

Have you used hnRNP G Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies