HOOK2 Antibody (8C9Q8)

Novus Biologicals | Catalog # NBP3-33543

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 8C9Q8
View all HOOK2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HOOK2 (Q96ED9).

Sequence:
MSVDKAELCGSLLTWLQTFHVPSPCASPQDLSSGLAVAYVLNQIDPSWFNEAWLQGISEDPGPNWKLKVSNLKMVLRSLVEYSQDVLAHPVSEEHLPDVS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HOOK2 Antibody (8C9Q8)

HOOK2 Antibody (8C9Q8)

Western Blot: HOOK2 Antibody (8C9Q8) [NBP3-33543] -

Western Blot: HOOK2 Antibody (8C9Q8) [NBP3-33543] - Western blot analysis of various lysates, using HOOK2at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.

Applications for HOOK2 Antibody (8C9Q8)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HOOK2

HOOK2 is 719 amino acids long, weighing 83 kDa, with a shorter isoform that is 717 amino acids long, also weighing approximately 83 kDa. HOOK2 is a hook protein, which functions as a component of the FTS/Hook/FHIP complex, which promotes vesicle function. HOOK2 also works to establish and maintain centrosome function and can work to help position and for aggresomes. HOOK2 has also been shown to have interactions with ABLIM1, AKTIP, APEX2, EPS8, and FAM107A.

Alternate Names

FLJ26218, hHK2, HK2h-hook2, hook homolog 2 (Drosophila), protein Hook homolog 2

Gene Symbol

HOOK2

Additional HOOK2 Products

Product Documents for HOOK2 Antibody (8C9Q8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HOOK2 Antibody (8C9Q8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOOK2 Antibody (8C9Q8)

There are currently no reviews for this product. Be the first to review HOOK2 Antibody (8C9Q8) and earn rewards!

Have you used HOOK2 Antibody (8C9Q8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies