HOXA6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87587

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all HOXA6 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HOXA6. Peptide sequence: YLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQPSGEDSE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HOXA6 Antibody - BSA Free

Western Blot: HOXA6 Antibody [NBP2-87587]

Western Blot: HOXA6 Antibody [NBP2-87587]

Western Blot: HOXA6 Antibody [NBP2-87587] - WB Suggested Anti-HOXA6 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Small Intestine

Applications for HOXA6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOXA6

HOXA6 is 233 amino acids long, weighing approximately 26 kDa, that functions as a sequence-specific transcription factor which focuses on the specific positional identities of cells on the anterior-posterior axis, which is all part of a developmental regulatory system. HOXA4 has also been shown to have interactions with PBX1, PBX3, PKNOX2, POLR2I, and POU2F1.

Alternate Names

homeo box A6, homeobox A6, Homeobox protein Hox-1B, homeobox protein HOXA6, homeobox protein Hox-A6, HOX1, HOX1.2, HOX1Bhomeo box 1B

Gene Symbol

HOXA6

Additional HOXA6 Products

Product Documents for HOXA6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOXA6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXA6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HOXA6 Antibody - BSA Free and earn rewards!

Have you used HOXA6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies