HOXB4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33833

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (97%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HOXB4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: CEAVSSSPPPPPCAQNPLHPSPSHSACKEPVVY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HOXB4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: HOXB4 Antibody [NBP2-33833]

Immunocytochemistry/ Immunofluorescence: HOXB4 Antibody [NBP2-33833]

Immunocytochemistry/Immunofluorescence: HOXB4 Antibody [NBP2-33833] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & centrosome.
Immunohistochemistry-Paraffin: HOXB4 Antibody [NBP2-33833]

Immunohistochemistry-Paraffin: HOXB4 Antibody [NBP2-33833]

Immunohistochemistry-Paraffin: HOXB4 Antibody [NBP2-33833] - Staining of human bone marrow shows strong positivity in hematopoietic cells.
HOXB4 Antibody

Immunohistochemistry-Paraffin: HOXB4 Antibody [NBP2-33833] -

Immunohistochemistry-Paraffin: HOXB4 Antibody [NBP2-33833] -Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
HOXB4 Antibody

Immunohistochemistry-Paraffin: HOXB4 Antibody [NBP2-33833] -

Immunohistochemistry-Paraffin: HOXB4 Antibody [NBP2-33833] - Staining of human skin shows no positivity in squamous epithelial cells.
HOXB4 Antibody

Immunohistochemistry-Paraffin: HOXB4 Antibody [NBP2-33833] -

Immunohistochemistry-Paraffin: HOXB4 Antibody [NBP2-33833] - Staining of human liver shows no positivity in hepatocytes.
HOXB4 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: HOXB4 Antibody - BSA Free [NBP2-33833]

Chromatin Immunoprecipitation-exo-Seq: HOXB4 Antibody - BSA Free [NBP2-33833]

ChIP-Exo-Seq composite graph for Anti-HOXB4 (NBP2-33833) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for HOXB4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOXB4

Homebox transcription factors (Hox) are encoded by highly conserved developmental genes that are involved embryonic and early hematopoietic development. Specifically, Homeobox B4 (HoxB4) is a transcription factor encoded by HOXB4 gene and it is involved in the developmental regulation of specific positional identities on the anterior-posterior axis of cells. Like all members of HOX family, HoXB4 is abundantly expressed in primitive hematopoietic stem cell (HSC), but then decline with lineage-specific terminal differentiation (1). In HSC, stem cell self-renewal activity is regulated by USF1/2 binding to HoxB4, where binding possibly favors stem cell self-renewal instead of cell differentiation. Jun-B and Fra-1 has been linked as key mediators during cell proliferation and differentiation induced by HoxB4, which leads to increase expression of Cyclin D1 and G1 shortening (2).

Long Name

Homeobox B4

Alternate Names

Hox-2.6, HOX2F

Gene Symbol

HOXB4

UniProt

P17483 (Human)

Additional HOXB4 Products

Product Documents for HOXB4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HOXB4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXB4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HOXB4 Antibody - BSA Free and earn rewards!

Have you used HOXB4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies