HOXB4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10514

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all HOXB4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HOXB4 (NP_076920). Peptide sequence TRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGAAGSA

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HOXB4 Antibody - BSA Free

Western Blot: HOXB4 Antibody [NBP3-10514]

Western Blot: HOXB4 Antibody [NBP3-10514]

Western Blot: HOXB4 Antibody [NBP3-10514] - Western blot analysis using NBP3-10514 on Transfected 293T as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for HOXB4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOXB4

Homebox transcription factors (Hox) are encoded by highly conserved developmental genes that are involved embryonic and early hematopoietic development. Specifically, Homeobox B4 (HoxB4) is a transcription factor encoded by HOXB4 gene and it is involved in the developmental regulation of specific positional identities on the anterior-posterior axis of cells. Like all members of HOX family, HoXB4 is abundantly expressed in primitive hematopoietic stem cell (HSC), but then decline with lineage-specific terminal differentiation (1). In HSC, stem cell self-renewal activity is regulated by USF1/2 binding to HoxB4, where binding possibly favors stem cell self-renewal instead of cell differentiation. Jun-B and Fra-1 has been linked as key mediators during cell proliferation and differentiation induced by HoxB4, which leads to increase expression of Cyclin D1 and G1 shortening (2).

Long Name

Homeobox B4

Alternate Names

Hox-2.6, HOX2F

Gene Symbol

HOXB4

Additional HOXB4 Products

Product Documents for HOXB4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOXB4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXB4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HOXB4 Antibody - BSA Free and earn rewards!

Have you used HOXB4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies