HOXC12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69214

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HOXC12 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to HOXC12 (homeobox C12) The peptide sequence was selected from the C terminal of HOXC12. Peptide sequence NSRSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HOXC12 Antibody - BSA Free

Western Blot: HOXC12 Antibody [NBP1-69214]

Western Blot: HOXC12 Antibody [NBP1-69214]

Western Blot: HOXC12 Antibody [NBP1-69214] - ACHN cell lysate, concentration 0.2-1 ug/ml.

Applications for HOXC12 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOXC12

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12.

Alternate Names

HOC3F, homeo box 3F, homeo box C12, homeobox C12, Homeobox protein Hox-3F, homeobox protein Hox-C12, HOX3FHOX3

Gene Symbol

HOXC12

UniProt

P31275 (Human)

Additional HOXC12 Products

Product Documents for HOXC12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HOXC12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXC12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HOXC12 Antibody - BSA Free and earn rewards!

Have you used HOXC12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies