HOXC6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85068

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat HOXC6. Peptide sequence: DFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQ The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for HOXC6 Antibody - BSA Free

Western Blot: HOXC6 Antibody [NBP2-85068]

Western Blot: HOXC6 Antibody [NBP2-85068]

Western Blot: HOXC6 Antibody [NBP2-85068] - Host: Rabbit. Target Name: Hoxc6. Sample Type: Rat Small Intestine lysates. Antibody Dilution: 1.0ug/ml

Applications for HOXC6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOXC6

The Hox proteins play a role in development and cellular differentiation by regulating downstream target genes. Specifically, the Hox proteins direct DNA-protein and protein-protein interactions that assist in determining the morphologic features associated with the anterior-posterior body axis. The mammalian Hox gene complex consists of 39 genes that are located on four linkage groups, which are dispersed over four chromosomes. Hox genes that occupy the same relative position along the 5' to 3' coordinate (trans-paralogous genes) are more similar in sequence and expression pattern than adjacent Hox genes on the same chromosome. HoxC6 sequence-specific transcription factor is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. HoxC6 may be a novel potential therapeutic target for prostate cancer.

Alternate Names

CP25, HHO.C8, homeo box 3C, homeo box C6, homeo box C8 protein, homeobox C6, Homeobox protein CP25, Homeobox protein HHO.C8, Homeobox protein Hox-3C, homeobox protein Hox-C6, HOX3CHOX3

Gene Symbol

HOXC6

Additional HOXC6 Products

Product Documents for HOXC6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOXC6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HOXC6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HOXC6 Antibody - BSA Free and earn rewards!

Have you used HOXC6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...