HSD3B7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56994

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HSD3B7 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to HSD3B7 (hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7) The peptide sequence was selected from the middle region of HSD3B7, within the residues: QGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HSD3B7 Antibody - BSA Free

Western Blot: HSD3B7 Antibody [NBP1-56994]

Western Blot: HSD3B7 Antibody [NBP1-56994]

Western Blot: HSD3B7 Antibody [NBP1-56994] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Applications for HSD3B7 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HSD3B7

This gene encodes an enzyme which is involved in the initial stages of the synthesis of bile acids from cholesterol and a member of the short-chain dehydrogenase/reductase superfamily. The encoded protein is a membrane-associated endoplasmic reticulum protein which is active against 7-alpha hydrosylated sterol substrates. Mutations in this gene are associated with a congenital bile acid synthesis defect which leads to neonatal cholestasis, a form of progressive liver disease. Multiple transcript variants encoding different isoforms have been found for this gene.

Alternate Names

3 beta-hydroxy-delta 5-C27-steroid oxidoreductase, 3 beta-hydroxysteroid dehydrogenase type 7, 3 beta-hydroxysteroid dehydrogenase type VII, 3-beta-HSD VII, 7-alpha-diol 3-beta-dehydrogenase, C(27) 3-beta-HSD, C(27)-3BETA-HSD, Cholest-5-ene-3-beta, EC 1.1.1.-, EC 1.1.1.181, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 7,3-beta-hydroxy-Delta(5)-C27 steroid oxidoreductase, PFIC4, SDR11E3, short chain dehydrogenase/reductase family 11E, member 3

Gene Symbol

HSD3B7

UniProt

Q9H2F3 (Human)

Additional HSD3B7 Products

Product Documents for HSD3B7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HSD3B7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HSD3B7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HSD3B7 Antibody - BSA Free and earn rewards!

Have you used HSD3B7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies