HSFY2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80247

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HSFY2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human HSFY2. Peptide sequence EMQGEPSFQPGFPHFSSSSSTYSDSKAKGEPELPIHKERVASTTLASTSN. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HSFY2 Antibody - BSA Free

Western Blot: HSFY2 Antibody [NBP1-80247]

Western Blot: HSFY2 Antibody [NBP1-80247]

Western Blot: HSFY2 Antibody [NBP1-80247] - NIH-3T3 cells lysate, concentration 2.5 ug/ml.

Applications for HSFY2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HSFY2

HSFY2 encodes a member of the heat shock factor (HSF) family of transcriptional activators for heat shock proteins. This gene is a candidate gene for azoospermia, since it localizes to a region of chromosome Y that is sometimes deleted in infertile males. The genome has two identical copies of this gene within a palindromic region; this record represents the more telomeric copy. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq]

Alternate Names

FLJ25453, Heat shock transcription factor 2-like protein, heat shock transcription factor, Y linked 2, heat shock transcription factor, Y-linked, HSF2L, HSF2-like, HSFY, HSFY1

Gene Symbol

HSFY2

UniProt

NP_081937 (Mouse)

Additional HSFY2 Products

Product Documents for HSFY2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HSFY2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HSFY2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HSFY2 Antibody - BSA Free and earn rewards!

Have you used HSFY2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies