Recombinant P. falciparum HSP90 Protein

Novus Biologicals | Catalog # NBP3-18321

Novus Biologicals
Loading...

Key Product Details

Applications

Western Blot, SDS-PAGE
Loading...

Product Specifications

Description

A partial recombinant protein corresponding to bacteria HSP90.

Source: E. coli

Amino Acid Sequence: QPVLEINPNHFIIKQLNHLIQIDKMNLQNSEIAEQIFDVASMQGGYTIDDTGLFAKRVIGMMEKNAEQYLMNVQSNISNNTLNNNTSGSEMPQNNSPNELQSEMKSTNGIDDNSNISENKINESSSNQNNIGENSIAEENNIKNIAESDVNKINLGENDVSQNTMHKQDSGLFNLDPSILNSNMLSGSDKTLL

Purity

>85%

Predicted Molecular Mass

21.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Protein / Peptide Type

Partial Recombinant Protein

Formulation, Preparation, and Storage

NBP3-18321
Preparation Method This protein is affinity purified.
Formulation 50mM Tris/HCl pH7.5, 300mM NaCl, 10% glycerol
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: HSP90

Hsp90 has at least 2 isoforms, Hsp90a and Hsp90b which are encoded by separate genes. These ubiquitous and highly conserved proteins account for 1-2% of all cellular proteins in most cells. Hsp90 is part of the cells powerful network of chaperones to fight the deleterious consequences of protein unfolding caused by nonphysiological conditions. However, in the absence of stress, Hsp90 is a necessary component of fundamental cellular processes such as hormone signaling and cell cycle control. In this context several key regulatory proteins such as steroid receptors, cell cycle kinases involved in signal transduction and p53 have been identified as substrates of Hsp90. It has been suggested that Hsp90 acts as a capacitor for morphological evolution by buffering widespread variation, which may affect morphogenic pathways.

Long Name

Heat Shock Protein 90

Alternate Names

FLJ31884, Heat shock 86 kDa, heat shock 90kD protein 1, alpha, heat shock 90kD protein 1, alpha-like 4, heat shock 90kD protein, alpha-like 4, heat shock 90kDa protein 1, alpha, heat shock protein 90kDa alpha (cytosolic), class A member 1, heat shock protein HSP 90-alpha, Hsp89, Hsp90, HSP90AHSP86, HSP90N, HSPC1HSP 86, HSPCAHSP89A, HSPCAL1, HSPCAL4, HSPN, LAP2, Renal carcinoma antigen NY-REN-38

Gene Symbol

HSP90AA1

Additional HSP90 Products

Product Documents for Recombinant P. falciparum HSP90 Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant P. falciparum HSP90 Protein

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant P. falciparum HSP90 Protein

There are currently no reviews for this product. Be the first to review Recombinant P. falciparum HSP90 Protein and earn rewards!

Have you used Recombinant P. falciparum HSP90 Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...

Associated Pathways

Apoptosis Signaling Pathway Apoptosis Signaling Pathway Thumbnail