HspA1B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-98547

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HspA1B Primary Antibodies »

Product Specifications

Immunogen

The immunogen for this antibody is HSPA1B - C-terminal region. Peptide sequence DKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HspA1B Antibody - BSA Free

Western Blot: HspA1B Antibody [NBP1-98547]

Western Blot: HspA1B Antibody [NBP1-98547]

Western Blot: HspA1B Antibody [NBP1-98547] - Titration: 1.0 ug/ml Positive Control: MDA-MB-435S Whole Cell.
Immunohistochemistry: HspA1B Antibody [NBP1-98547]

Immunohistochemistry: HspA1B Antibody [NBP1-98547]

Immunohistochemistry: HspA1B Antibody [NBP1-98547] - Human Adult Prostate Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.

Applications for HspA1B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HspA1B

This intronless gene encodes a 70kDa heat shock protein which is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which encode similar proteins.

Alternate Names

FLJ54328, Heat shock 70 kDa protein 1/2, heat shock 70 kDa protein 1A/1B, heat shock 70kD protein 1B, heat shock 70kDa protein 1B, HSP70.1/HSP70.2, HSP70-1/HSP70-2, HSP70-1B, HSP70-2, HSPA1, HSPA1A

Gene Symbol

HSPA1B

UniProt

NP_005337 (Human)

Additional HspA1B Products

Product Documents for HspA1B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HspA1B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HspA1B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HspA1B Antibody - BSA Free and earn rewards!

Have you used HspA1B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies