HspA1L Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56938

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to HSPA1L(heat shock 70kDa protein 1-like) The peptide sequence was selected from the C terminal of HSPA1L (NP_005518). Peptide sequence DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HspA1L Antibody - BSA Free

Western Blot: HspA1L Antibody [NBP1-56938]

Western Blot: HspA1L Antibody [NBP1-56938]

Western Blot: HspA1L Antibody [NBP1-56938] - Recommended Titration: 0.2 - 1 ug/ml Positive Control: Jurkat cell lysate
Western Blot: HspA1L Antibody [NBP1-56938]

Western Blot: HspA1L Antibody [NBP1-56938]

Western Blot: HspA1L Antibody [NBP1-56938] - Sample Type: 1. Lamprey CNS (20ug) 2. Rat Brain Lysate (20ug) Primary Dilution: 1:1000 Secondary Antibody: Goat anti-Rabbit HRP Secondary Dilution: 1:4000
Western Blot: HspA1L Antibody [NBP1-56938]

Western Blot: HspA1L Antibody [NBP1-56938]

Western Blot: HspA1L Antibody [NBP1-56938] - Sample Tissue: Human MDA-MB-435s Antibody Dilution: 1.0 ug/ml

Applications for HspA1L Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HspA1L

HSPA1L is a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. This gene encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which also encode isoforms of the 70kDa heat shock protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

heat shock 10kDa protein 1-like, Heat shock 70 kDa protein 1-Hom, Heat shock 70 kDa protein 1L, heat shock 70 kDa protein 1-like, heat shock 70kD protein-like 1, heat shock 70kDa protein 1-like, HSP70-1L, HSP70-Hom, HSP70T, hum70t

Entrez Gene IDs

3305 (Human)

Gene Symbol

HSPA1L

UniProt

Additional HspA1L Products

Product Documents for HspA1L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HspA1L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HspA1L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HspA1L Antibody - BSA Free and earn rewards!

Have you used HspA1L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...