Hydrogen Potassium ATPase Beta Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-60028

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Hydrogen Potassium ATPase Beta Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ATP4B(ATPase, H+/K+ exchanging, beta polypeptide) The peptide sequence was selected from the middle region of ATP4B (NP_000696). Peptide sequence QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: beta.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Hydrogen Potassium ATPase Beta Antibody - BSA Free

Western Blot: Hydrogen Potassium ATPase Beta Antibody [NBP1-60028]

Western Blot: Hydrogen Potassium ATPase Beta Antibody [NBP1-60028]

Western Blot: Hydrogen Potassium ATPase Beta Antibody [NBP1-60028] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.

Applications for Hydrogen Potassium ATPase Beta Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Hydrogen Potassium ATPase Beta

ATP4B belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase.The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Potassium-transporting ATPase subunit beta

Alternate Names

ATP4B

Entrez Gene IDs

496 (Human)

Gene Symbol

ATP4B

UniProt

P51164 (Human)

Additional Hydrogen Potassium ATPase Beta Products

Product Documents for Hydrogen Potassium ATPase Beta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Hydrogen Potassium ATPase Beta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Hydrogen Potassium ATPase Beta Antibody - BSA Free

Customer Reviews for Hydrogen Potassium ATPase Beta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Hydrogen Potassium ATPase Beta Antibody - BSA Free and earn rewards!

Have you used Hydrogen Potassium ATPase Beta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for Hydrogen Potassium ATPase Beta Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: What is expression system of this peptide made from? Mammalian cell or bacteria?

    A: The lab informed me that the 14aa peptide was generated by our in house peptide synthesizers from individual amino acids, and not from a cell base expression system.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies