Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55294

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Hydroxyacid Oxidase-1/HAO-1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to HAO1(hydroxyacid oxidase (glycolate oxidase) 1) The peptide sequence was selected from the C terminal of HAO1. Peptide sequence GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free

Western Blot: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP1-55294]

Western Blot: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP1-55294]

Western Blot: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP1-55294] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Applications for Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Hydroxyacid Oxidase-1/HAO-1

Subcellular location of HAO1 is the peroxisome. Specifically, HAO1 is expressed primarily in liver and pancreas and is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids.This gene is one of three related genes that have 2-hydroxyacid oxidase activity yet differ in encoded protein amino acid sequence, tissue expression and substrate preference. Subcellular location of the encoded protein is the peroxisome. Specifically, this gene is expressed primarily in liver and pancreas and the encoded protein is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids. The transcript detected at high levels in pancreas may represent an alternatively spliced form or the use of a multiple near-consensus upstream polyadenylation site.

Alternate Names

GOX, HAO-1, HAO1, HAOX1, Hydroxyacid Oxidase1

Gene Symbol

HAO1

UniProt

Q9UJM8 (Human)

Additional Hydroxyacid Oxidase-1/HAO-1 Products

Product Documents for Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Oxidases and Oxygenases
Redox Enzymes

Customer Reviews for Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free and earn rewards!

Have you used Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies