HYPB Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03807

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all HYPB Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 2475-2564 of human HYPB (NP_054878.5). RKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HYPB Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: HYPB Antibody - Azide and BSA Free [NBP3-03807]

Immunocytochemistry/ Immunofluorescence: HYPB Antibody - Azide and BSA Free [NBP3-03807]

Immunocytochemistry/Immunofluorescence: HYPB Antibody [NBP3-03807] - Analysis of U-2 OS cells using HYPB antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: HYPB Antibody - Azide and BSA Free [NBP3-03807]

Immunocytochemistry/ Immunofluorescence: HYPB Antibody - Azide and BSA Free [NBP3-03807]

Immunocytochemistry/Immunofluorescence: HYPB Antibody [NBP3-03807] - Analysis of C6 cells using HYPB antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
HYPB Antibody - Azide and BSA Free

Western Blot: HYPB Antibody [NBP3-03807] -

Western Blot: HYPB Antibody [NBP3-03807] - analysis of lysates from Mouse spleen, using SETD2 Rabbit pAb at 1:900 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.
HYPB Antibody - Azide and BSA Free

Immunoprecipitation- HYPB Antibody [NBP3-03807] -

Immunoprecipitation- HYPB Antibody [NBP3-03807] - Analysis of 600 μg extracts of Mouse spleen using 3 μg SETD2 antibody. Western blot was performed from the immunoprecipitate using SETD2 antibody at a dilution of 1:1000.
HYPB Antibody - Azide and BSA Free

Immunohistochemistry: HYPB Antibody - Azide and BSA Free [HYPB] -

Immunohistochemistry: HYPB Antibody - Azide and BSA Free [HYPB] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using HYPB Rabbit pAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
HYPB Antibody - Azide and BSA Free

Immunohistochemistry: HYPB Antibody - Azide and BSA Free [HYPB] -

Immunohistochemistry: HYPB Antibody - Azide and BSA Free [HYPB] - Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using HYPB Rabbit pAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
HYPB Antibody - Azide and BSA Free

Immunohistochemistry: HYPB Antibody - Azide and BSA Free [HYPB] -

Immunohistochemistry: HYPB Antibody - Azide and BSA Free [HYPB] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using HYPB Rabbit pAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
HYPB Antibody - Azide and BSA Free

Immunohistochemistry: HYPB Antibody - Azide and BSA Free [HYPB] -

Immunohistochemistry: HYPB Antibody - Azide and BSA Free [HYPB] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using HYPB Rabbit pAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Applications for HYPB Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Immunoprecipitation

0.5ug-4ug antibody for 400ug-600ug extracts of whole cells

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HYPB

Huntington's disease (HD), a neurodegenerative disorder characterized by loss of striatal neurons, is caused by an expansion of a polyglutamine tract in the HD protein huntingtin. This gene encodes a protein belonging to a class of huntingtin interacting proteins characterized by WW motifs. This protein is a histone methyltransferase that is specific for lysine-36 of histone H3, and methylation of this residue is associated with active chromatin. This protein also contains a novel transcriptional activation domain and has been found associated with hyperphosphorylated RNA polymerase II. (provided by RefSeq)

Alternate Names

FLJ22472, FLJ23184, FLJ45883, FLJ46217, HIF1, HIF-1EC 2.1.1.43, HIP-1, histone-lysine N-methyltransferase SETD2, hSET2, huntingtin interacting protein 1, Huntingtin yeast partner B, Huntingtin-interacting protein 1, Huntingtin-interacting protein B, HYPBp231HBP, KIAA1732SET domain-containing protein 2, KMT3AHBP231, Lysine N-methyltransferase 3A, SET domain containing 2, SET2FLJ16420

Gene Symbol

SETD2

Additional HYPB Products

Product Documents for HYPB Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HYPB Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HYPB Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review HYPB Antibody - Azide and BSA Free and earn rewards!

Have you used HYPB Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies