ICEBERG Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85088

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ICEBERG Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ICEBERG. Peptide sequence: DEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ICEBERG Antibody - BSA Free

Western Blot: ICEBERG Antibody [NBP2-85088]

Western Blot: ICEBERG Antibody [NBP2-85088]

Western Blot: ICEBERG Antibody [NBP2-85088] - WB Suggested Anti-CAR18 antibody Titration: 1 ug/mL. Sample Type: Human Ovary Tumor

Applications for ICEBERG Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ICEBERG

ICEBERG, also known as Caspase recruitment domain-containing protein 18, is a 90 amino acid protein that is 10 kDa, most often expressed in the heart and placenta, down-regulates the release of IL1B, and by interacting with caspase-1 and preventing its association with RIP2 inhibits the generation of IL-1-beta. This protein is being studied for its involvement in chronic lymphocytic leukemia. The ICEBERG protein has been linked to the NOD-like receptor signaling pathway where it interacts with CASP1, CARD8, CARD16, and CARD17.

Alternate Names

caspase recruitment domain family, member 18, Caspase-1 inhibitor Iceberg, ICEBERG caspase-1 inhibitor, ICEBERGcaspase recruitment domain-containing protein 18, pseudo-ICE, UNQ5804

Gene Symbol

CARD18

Additional ICEBERG Products

Product Documents for ICEBERG Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ICEBERG Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ICEBERG Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ICEBERG Antibody - BSA Free and earn rewards!

Have you used ICEBERG Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies