ID4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10934

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ID4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ID4 (NP_001537). Peptide sequence CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ID4 Antibody - BSA Free

Western Blot: ID4 Antibody [NBP3-10934]

Western Blot: ID4 Antibody [NBP3-10934]

Western Blot: ID4 Antibody [NBP3-10934] - Western blot analysis using NBP3-10934 on Human HEK293T as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for ID4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ID4

Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes ina number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo-and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain theHLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA andtranscriptional transactivation by heterodimerization with bHLH proteins (Pagliuca et al., 1995 (PubMed7665172)).(supplied by OMIM)

Long Name

Inhibitor of DNA Binding 4

Alternate Names

Idb4

Gene Symbol

ID4

Additional ID4 Products

Product Documents for ID4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ID4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ID4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ID4 Antibody - BSA Free and earn rewards!

Have you used ID4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies