IFN-alpha B2/IFN-alpha 8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-82256

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all IFN-alpha B2/IFNA8 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFN-alpha B2/IFN-alpha 8. Peptide sequence: ILAVRKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSINLQKRLKSKE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for IFN-alpha B2/IFN-alpha 8 Antibody - BSA Free

Western Blot: IFN-alpha B2/IFN-alpha 8 Antibody [NBP2-82256]

Western Blot: IFN-alpha B2/IFN-alpha 8 Antibody [NBP2-82256]

Western Blot: IFN-alpha B2/IFN-alpha 8 Antibody [NBP2-82256] - Host: Rabbit. Target Name: IFNA8. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

Applications for IFN-alpha B2/IFN-alpha 8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IFN-alpha B2/IFNA8

Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of twoenzymes: a protein kinase and an oligoadenylate synthetase

Long Name

Interferon alpha 8

Alternate Names

IFN-alpha B2, IFNA8, IFNalpha B2

Gene Symbol

IFNA8

Additional IFN-alpha B2/IFNA8 Products

Product Documents for IFN-alpha B2/IFN-alpha 8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IFN-alpha B2/IFN-alpha 8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Interferons

Customer Reviews for IFN-alpha B2/IFN-alpha 8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IFN-alpha B2/IFN-alpha 8 Antibody - BSA Free and earn rewards!

Have you used IFN-alpha B2/IFN-alpha 8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies