IFN-alpha WA/IFNA16 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86674

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFN-alpha WA/IFNA16. Peptide sequence: ILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for IFN-alpha WA/IFNA16 Antibody - BSA Free

Western Blot: IFN-alpha WA/IFNA16 Antibody [NBP2-86674]

Western Blot: IFN-alpha WA/IFNA16 Antibody [NBP2-86674]

Western Blot: IFN-alpha WA/IFNA16 Antibody [NBP2-86674] - Host: Rabbit. Target Name: IFNA16. Sample Type: ACHN whole cell lysates. Antibody Dilution: 1.0ug/ml

Applications for IFN-alpha WA/IFNA16 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IFNA16

IFNA16, also known as Interferon alpha-16, is a 189 amino acid protein that is 22 kDa, belongs to the alpha/beta interferon family, produced by macrophages has antiviral activities, and stimulates the production of protein kinase and oligoadenylate synthetase. Current research is being performed on several diseases and disorders including interferon, dengue hemorrhagic fever, immunodeficiency, hemorrhagic fever, autoimmune thyroiditis, measles, influenza, melanoma, tuberculosis, thyroiditis, hepatitis c, hepatitis, leukemia, and papillomatosis. This protein has shown to have interactions with IFNAR1, IFNAR2, IFNGR1, and IFNGR2 in pathways such as cytokine-cytokine receptor interaction, regulation of autophagy, toll-like receptor signaling pathway, RIG-I-like receptor signaling pathway, cytosolic DNA-sensing pathway, JAK-STAT pathway, all-trans-retinoic acid mediated apoptosis, and hemostasis pathway.

Long Name

Interferon alpha 16

Alternate Names

BC114392, Gm13280, IFN-alpha 16, IFN-alpha WA, IFN-alpha-WA, Ifna6T, IFNalpha WA, Ifnat6, Interferon Alpha-WA

Gene Symbol

IFNA16

Additional IFNA16 Products

Product Documents for IFN-alpha WA/IFNA16 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IFN-alpha WA/IFNA16 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for IFN-alpha WA/IFNA16 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IFN-alpha WA/IFNA16 Antibody - BSA Free and earn rewards!

Have you used IFN-alpha WA/IFNA16 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...