IGF2BP3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-68981

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all IGF2BP3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to Igf2bp3 (insulin-like growth factor 2 mRNA binding protein 3) The peptide sequence was selected from the middle region of Igf2bp3 (NP_076159). Peptide sequence QQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAI. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for IGF2BP3 Antibody - BSA Free

Western Blot: IGF2BP3 Antibody [NBP1-68981]

Western Blot: IGF2BP3 Antibody [NBP1-68981]

Western Blot: IGF2BP3 Antibody [NBP1-68981] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Kidney.

Applications for IGF2BP3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IGF2BP3

Igf2bp3 is a RNA-binding protein that act as a regulator of mRNA translation and stability. Igf2bp3 binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Igf2bp3 binds to sequences in the 3'-UTR of CD44 mRNA.

Alternate Names

CT98, hKOC, IGF II mRNA binding protein 3, IGF2 mRNA-binding protein 3, IGF-II mRNA-binding protein 3, IMP-3KH domain-containing protein overexpressed in cancer, IMP3VICKZ family member 3, insulin-like growth factor 2 mRNA binding protein 3, insulin-like growth factor 2 mRNA-binding protein 3, KH domain containing protein overexpressed in cancer, KOC1DKFZp686F1078, VICKZ3cancer/testis antigen 98

Entrez Gene IDs

10643 (Human); 140488 (Mouse)

Gene Symbol

IGF2BP3

UniProt

Q9CPN8 (Mouse)

Additional IGF2BP3 Products

Product Documents for IGF2BP3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for IGF2BP3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IGF2BP3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IGF2BP3 Antibody - BSA Free and earn rewards!

Have you used IGF2BP3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies