Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

DyLight 680 (Excitation = 692 nm, Emission = 712 nm)

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 46N8G7
View all IL-17RE Primary Antibodies »

Product Specifications

Immunogen

amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Applications for IL-17RE Antibody (46N8G7) [DyLight 680]

Application
Recommended Usage

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein G purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: IL-17RE

Interleukin-17 Receptor E (IL-17RE) is a transmembrane protein that is expressed on mucosal epithelial cells, keratinocytes, Th17 cells, and gamma delta T cells. It associates with IL-17RA to form a heterodimeric receptor for IL-17C. Binding of IL-17C to this receptor complex promotes mucosal immunity by stimulating the production of anti-bacterial peptides and pro-inflammatory cytokines and chemokines. Additionally, IL-17C signaling regulates Th17 cell-dependent immune responses and has been suggested to contribute to psoriatic skin thickening, the progression of arthritis, and the pathogenesis of autoimmune diseases.

Long Name

Interleukin 17 Receptor E

Alternate Names

IL-17 RE, IL17RE, Il25r

Gene Symbol

IL17RE

Additional IL-17RE Products

Product Documents for IL-17RE Antibody (46N8G7) [DyLight 680]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for IL-17RE Antibody (46N8G7) [DyLight 680]



DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IL-17RE Antibody (46N8G7) [DyLight 680]

There are currently no reviews for this product. Be the first to review IL-17RE Antibody (46N8G7) [DyLight 680] and earn rewards!

Have you used IL-17RE Antibody (46N8G7) [DyLight 680]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

IL-17 Family Signaling Pathways IL-17 Family Signaling Pathway Thumbnail