IL-28R alpha/IFN-lambda R1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69635

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to IL28RA(interleukin 28 receptor, alpha (interferon, lambda receptor)) The peptide sequence was selected from the N terminal of IL28RA. Peptide sequence EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF. The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: alpha.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for IL-28R alpha/IFN-lambda R1 Antibody - BSA Free

Western Blot: IL-28R alpha/IFN-lambda R1 Antibody [NBP1-69635]

Western Blot: IL-28R alpha/IFN-lambda R1 Antibody [NBP1-69635]

Western Blot: IL-28 R alpha/IFN-lambda R1 Antibody [NBP1-69635] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
Western Blot: IL-28R alpha/IFN-lambda R1 Antibody [NBP1-69635]

Western Blot: IL-28R alpha/IFN-lambda R1 Antibody [NBP1-69635]

Western Blot: IL-28 R alpha/IFN-lambda R1 Antibody [NBP1-69635] - This Anti-IL28RA antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.

Applications for IL-28R alpha/IFN-lambda R1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IL-28 R alpha/IFN-lambda R1

IL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.

Long Name

Interleukin 28 Receptor alpha

Alternate Names

CRF2-12, IFN-lambda R1, IFNLR1, IL-28Ra, IL28R alpha, IL28RA, LICR2

Gene Symbol

IFNLR1

UniProt

Additional IL-28 R alpha/IFN-lambda R1 Products

Product Documents for IL-28R alpha/IFN-lambda R1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IL-28R alpha/IFN-lambda R1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for IL-28R alpha/IFN-lambda R1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IL-28R alpha/IFN-lambda R1 Antibody - BSA Free and earn rewards!

Have you used IL-28R alpha/IFN-lambda R1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...