IL-38/IL-1F10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91501

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all IL-38/IL-1F10 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human IL1F10. Peptide sequence SRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for IL-38/IL-1F10 Antibody - BSA Free

Western Blot: IL-38/IL-1F10 Antibody [NBP1-91501]

Western Blot: IL-38/IL-1F10 Antibody [NBP1-91501]

Western Blot: IL-38/IL-1F10 Antibody [NBP1-91501] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.

Applications for IL-38/IL-1F10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IL-38/IL-1F10

Human IL-38/IL-1F10 is a secreted cytokine belonging to the IL-1 family. It is synthesized as a 152 amino acid mature protein that lacks an identifiable signal sequence. It binds to soluble IL-1 R1. Human IL-38 shares 82% aa sequence identity with mouse IL-1F10. Human IL-38 also shares 39% and 27% aa sequence identity with IL-1ra and IL-1 beta, respectively.

Long Name

Interleukin 1 Family Member 10

Alternate Names

FIL1- theta, FKSG75, IL-1HY2, IL1F10, IL38

Gene Symbol

IL1F10

UniProt

NP_115945 (Human)

Additional IL-38/IL-1F10 Products

Product Documents for IL-38/IL-1F10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for IL-38/IL-1F10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

IL-1 Family

Customer Reviews for IL-38/IL-1F10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IL-38/IL-1F10 Antibody - BSA Free and earn rewards!

Have you used IL-38/IL-1F10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

IL-1 Family Signaling Pathways IL-1 Family Signaling Pathway Thumbnail